Stability testing is one of those subjects where the details matter more than the headlines. This page pulls together the background, the mechanisms, and the practical points readers ask about most.
Last reviewed on 2026-07-01. Where a claim depends on a specific study, the study is described rather than over-claimed.
Solid creatine monohydrate is relatively stable when kept dry and sealed, but heat and moisture accelerate its conversion to creatinine. This degradation involves intramolecular cyclization, a process that removes water and forms a less useful compound for phosphocreatine metabolism. Powder stored under cool, dry conditions can remain within specification for extended periods, though exact shelf life depends on packaging, humidity, and initial purity. Aqueous solutions degrade faster than dry powder, with pH and temperature influencing the rate. Because degradation is gradual, analytical testing is used to confirm potency at manufacture and during stability studies.
Quality control for creatine monohydrate typically combines identity, assay, and impurity tests. High-performance liquid chromatography with ultraviolet detection is common for separating creatine from creatinine and related substances. Nuclear magnetic resonance and infrared spectroscopy can confirm molecular structure, while titration may assess acid-base content. Moisture content, heavy metals, residual solvents, and microbial limits are checked according to applicable standards. These tests help distinguish compliant material from powders that have degraded, been diluted, or contain manufacturing residues.
Creatine monohydrate is a crystalline organic compound formed from creatine and water in a one-to-one ratio. It belongs to the guanidino family and contains a methylated guanidine group attached to an acetate-like chain. The solid is commonly described as a white, odorless powder with a mildly bitter taste. Its molecular formula is C4H11N3O3·H2O, and the hydrated form is the most widely traded grade. The compound occurs naturally in vertebrate muscle and brain tissue, where it participates in rapid energy buffering.
In aqueous solution, creatine monohydrate exists mainly as a zwitterion, carrying both a positive guanidinium charge and a negative carboxylate charge. This charge separation raises water solubility relative to many neutral organic solids and helps explain its behavior in analytical separations. The monohydrate can lose its water of crystallization under sustained heat or low humidity, converting toward anhydrous creatine. Such transitions matter for mass balance calculations because the hydrate contributes water mass that is not part of the active creatine molecule.
The term creatine monohydrate is often shortened to creatine in casual usage, though other creatine forms exist, including citrate, nitrate, and hydrochloride salts. These alternative forms differ in solubility, pH behavior, and the amount of creatine delivered per unit mass. Regulatory categories vary by country: some jurisdictions treat it as a food ingredient, while others place it under supplement or drug frameworks depending on claims and presentation. Standard reference texts list it as a naturally occurring nitrogenous organic acid rather than a vitamin or mineral.
| Property | Value | Notes |
|---|---|---|
| Typical storage temperature | 15–25 °C | Cool, dry, sealed |
| Relative humidity | Below 60% | Moisture promotes caking and degradation |
| Degradation product | Creatinine | Forms by cyclization, especially in solution |
| Assay method | HPLC with UV detection | Often paired with identity tests |
| Aqueous stability | Hours to days at room temperature | Depends on pH, temperature, concentration |
The compound was identified in the nineteenth century after chemists isolated a nitrogenous substance from meat extracts. Later work established its role in muscle energy metabolism and its conversion to phosphocreatine. Chemical synthesis of creatine followed, and industrial production made the monohydrate widely available as a purified powder. Interest expanded in the late twentieth century when researchers began studying creatine supplementation and muscle physiology. Historical accounts sometimes differ on exact dates and attributions, but the broad sequence from tissue extracts to synthetic production is well documented.
In the body, creatine is obtained from dietary meat and fish and is also synthesized from arginine, glycine, and methionine. Muscle stores creatine and phosphocreatine, which participate in the rapid regeneration of adenosine triphosphate during short, intense activity. The monohydrate form is used in research because it is chemically defined, stable as a dry solid, and relatively inexpensive to produce. Questions remain about whether other creatine forms offer meaningful advantages in absorption or tissue retention, and findings vary across studies and populations.
Creatine monohydrate is one of several solid forms of creatine described in the literature. Other forms include anhydrous creatine, creatine hydrochloride, and creatine ethyl ester, each with different solubility and stability characteristics. The monohydrate is distinct from creatinine, a spontaneous breakdown compound that forms when creatine loses water and cyclizes. Commercial descriptions sometimes use synonyms such as methylguanidoacetic acid or N-(aminoiminomethyl)-N-methylglycine, which refer to the same base molecule. These names appear in chemical databases and product labels.
Creatine monohydrate is a crystalline compound formed when one molecule of creatine binds with one molecule of water. Creatine itself is a nitrogen-containing organic acid involved in cellular energy transfer, particularly in muscle and nerve tissue. The monohydrate form is the most common solid form used in research and commercial products because it is relatively stable and easy to handle. Its molecular formula is C4H9N3O2·H2O, and its molar mass is about 149.15 grams per mole.
In the human body, creatine is synthesized mainly in the liver and kidneys from the amino acids glycine, arginine, and methionine. Dietary sources include meat, fish, and other animal tissues, which supply preformed creatine. Because plant foods contain little or no creatine, dietary intake varies widely among populations. The compound is stored largely in skeletal muscle, where it is converted to phosphocreatine and used to regenerate adenosine triphosphate during short bursts of activity.
Stability studies typically examine the effects of temperature, humidity, and light on creatine monohydrate. Sealed containers stored in cool, dry conditions help limit moisture uptake and hydrolysis. Elevated temperature and high relative humidity can accelerate conversion to creatinine, especially in aqueous solutions. In solid dosage forms, excipients and processing steps may also affect stability. Published stability data are not fully consistent across studies because test conditions and analytical methods vary.
Quality control of creatine monohydrate relies on a combination of identity, purity, and moisture tests. High-performance liquid chromatography with ultraviolet detection is widely used to separate creatine from creatinine and other related nitrogenous compounds. Spectroscopic methods such as infrared and nuclear magnetic resonance provide structural confirmation. Because the material is a hydrate, water content is measured separately, often by Karl Fischer titration. These tests together establish whether a lot meets a defined specification.
As a supplement, creatine monohydrate is studied for its effects on muscle performance and recovery. The compound is often described as an ergogenic aid, meaning it may support physical work capacity. Research typically compares it with placebo or other forms, such as citrate or nitrate, under controlled conditions. Questions remain about the optimal dose and long-term effects in different populations, and findings are not uniform across all studies. The monohydrate form remains the most extensively tested.
Creatine monohydrate is a crystalline compound formed from creatine and one molecule of water. Its systematic name is N-(aminoiminomethyl)-N-methylglycine monohydrate, and it appears as a white, odorless powder with limited solubility in water. The monohydrate is the most common solid form used in research and commercial products because it is stable under dry conditions. The anhydrous form lacks the water of crystallization and differs slightly in molar mass. Both forms participate in the same biochemical reactions once dissolved.
In the body, creatine is synthesized from the amino acids arginine, glycine, and methionine, primarily in the liver and kidneys. It is transported to muscle and other tissues, where it is phosphorylated to phosphocreatine by creatine kinase. This phosphagen system provides a rapid source of adenosine triphosphate during short, intense contractions. Dietary creatine comes mainly from meat and fish, and the body's total pool is influenced by both synthesis and intake.
== Chemistry == Grammotoxin is a 36 amino acid protein toxin, with the sequence Asp-Cys-Val-Arg-Phe-Trp-Gly-Lys-Cys-Ser-Gln-Thr-Ser-Asp-Cys-Cys-Pro-His-Leu-Ala-Cys-Lys-Ser-Lys-Trp-Pro-Arg-Asn-Ile-Cys-Val-Trp-Asp-Gly-Ser-Val (DCVRFWGKCSQTSDCCPHLACKSKWPRNICVWDGSV), and disulfide bridges between Cys2-Cys16, Cys9-Cys21 and Cys15-Cys30. It forms an inhibitor cystine knot motif, common in spider toxins. Its chemical formula is: C177H268N52O50S6 Grammotoxin can be purified from Grammostola spatulata venom by reverse phase high performance liquid chromatography.
Willes (1963), former president of the Federal Reserve Bank of Minneapolis, CEO and Publisher of Los Angeles Times and Deseret Management Corporation Harry Saal (1963), co-founder of Network General Corporation, developer of the Sniffer Steven Clifford (1964), former CEO of King Broadcasting Company and National Mobile Television Arthur Cutler (1965), restaurateur, founder of Carmine's, Ollie's, and owner of Murray's Sturgeon Shop Ed Goodgold (1965), music industry executive and former manager of Sha Na Na, coined the term "trivia" Michael Gould (1966), former CEO of Bloomingdale's Julian Geiger (1967), former CEO of Aéropostale and current CEO of Crumbs Bake Shop Richard Sackler (1967), billionaire chairman and president of Purdue Pharma known for the development of Oxycontin Denny Greene (1971), former executive at Columbia Pictures, professor at University of Dayton School of Law, and member of Sha Na Na Mark E. Kingdon (1971), hedge fund manager, president of Kingdon Capital Management Philip L. Milstein (1971), former chairman and CEO of Emigrant Savings Bank, son of billionaire real estate developer Seymour Milstein Christopher M. Jeffries (1972), real estate developer, former husband of Princess Yasmin Aga Khan Marc Porat (1972), entrepreneur in information technology and sustainable materials; co-founder of General Magic John R. Eckel Jr. (1973), founder, CEO and chairman of Copano Energy Finbarr O'Neill (1973), former CEO of J.D. Power Fred Seibert (1973), TV producer and first creative director of MTV Robert B.
=== Illinois === Phlebotomists are not licensed in Illinois but must have a high school diploma and have completed a training program to practice. Certification is not required and phlebotomists do not fall under the Illinois Clinical Laboratory Act. In 2020, Illinois passed a bill requiring the Illinois Department of Public Health to triannually develop training materials for drawing blood from children and adults with intellectual and developmental disabilities and for facilities to ensure the training is incorporated for phlebotomists. There have been bills to introduce phlebotomy licensure in Illinois, but have been unsuccessful.
Sources: en.wikipedia.org
Loperamide is an opioid-receptor agonist and acts on the μ-opioid receptors in the myenteric plexus of the large intestine. It works like morphine, decreasing the activity of the myenteric plexus, which decreases the tone of the longitudinal and circular smooth muscles of the intestinal wall. This increases the time material stays in the intestine, allowing more water to be absorbed from the fecal matter. It also decreases colonic mass movements and suppresses the gastrocolic reflex. Loperamide's circulation in the bloodstream is limited in two ways. Efflux by P-glycoprotein in the intestinal wall reduces the passage of loperamide, and the fraction of drug crossing is then further reduced through first-pass metabolism by the liver. Loperamide metabolizes into an MPTP-like compound, but is unlikely to exert neurotoxicity.
== External links == AmBisome Summaries of Product Characteristics (United Kingdom) Amphotericin B "Amphotericin B Liposomal Injection". MedlinePlus. "Amphotericin B Lipid Complex Injection". MedlinePlus.
=== Chagas disease === Several studies have implicated açaí fruit in the transmission of Chagas disease. This is a risk when unpasteurized uncleaned fruits are consumed, and has been found in the regions where the fruit is harvested.
=== Autoimmune disorders === People with type 1 diabetes are at an increased risk for developing several autoimmune disorders, particularly thyroid problems – around 20% of people with type 1 diabetes have hypothyroidism or hyperthyroidism, typically caused by Hashimoto thyroiditis or Graves' disease respectively. Celiac disease affects 2–8% of people with type 1 diabetes, and is more common in those who were younger at diabetes diagnosis, and in white people. Type 1 diabetics are also at increased risk of rheumatoid arthritis, lupus, autoimmune gastritis, pernicious anemia, vitiligo, and Addison's disease. Conversely, complex autoimmune syndromes caused by mutations in the immunity-related genes AIRE (causing autoimmune polyglandular syndrome), FoxP3 (causing IPEX syndrome), or STAT3 include type 1 diabetes in their effects.
Sources: en.wikipedia.org
In children, orthodontic treatment to expand the volume of the nasal airway, such as nonsurgical rapid palatal expansion, is common. Since the palatal suture is fused in adults, regular RPE using tooth-borne expanders cannot be performed. Mini-implant-assisted rapid palatal expansion (MARPE) has been recently developed as a non-surgical option for the transverse expansion of the maxilla in adults. This method increases the volume of the nasal cavity and nasopharynx, leading to increased airflow and reduced respiratory arousals during sleep. Changes are permanent with minimal complications.
=== Netherlands === A ban on beak trimming in the Netherlands was first announced in 1996, but due to objections from the poultry sector it was delayed for years. In June 2013, the government struck an agreement between poultry farmers and animal welfare groups to phase out debeaking and prohibit it in 2018. The prohibition on trimming eventually went into effect on 1 January 2019.
== Adverse effects == Common side effects include low blood pressure, cough, hyperkalemia, headache, dizziness, fatigue, nausea, and kidney impairment. The main adverse effects of ACE inhibition can be understood from their pharmacological action. The other reported adverse effects are liver problems and effects on the fetus. Kidney problems may occur with all ACE inhibitors that directly follows from their mechanism of action. However, the decrease may be significant in conditions of pre-existing decreased renal perfusions, such as renal artery stenosis, heart failure, polycystic kidney disease, or volume depletion. In these patients, the maintenance of GFR depends on angiotensin-II-dependent efferent vasomotor tone. Therefore, renal function should be closely monitored over the first few days after initiation of treatment with ACE inhibitor in patients with decreased renal perfusion. Generally, a moderate reduction in renal function (no greater than 30% rise in serum creatinine which stabilizes within 2–4 weeks) is considered acceptable as part of the therapeutic effect. Reduced GFR is especially a problem if the patient is concomitantly taking an NSAID and a diuretic. When the three drugs are taken together, the risk of developing renal failure is significantly increased. Hyperkalemia, or high blood potassium, is a common adverse effect of treatment in 2% to 6% of patients. Suppression of angiotensin II leads to a decrease in aldosterone levels. Since aldosterone is responsible for increasing the excretion of potassium, ACE inhibitors can cause retention of potassium.
== Synthesis == Guanylate cyclase (GC) catalyzes cGMP synthesis. This enzyme converts GTP to cGMP. Peptide hormones such as the atrial natriuretic factor activate membrane-bound GC, while soluble GC (sGC) is typically activated by nitric oxide to stimulate cGMP synthesis. sGC can be inhibited by ODQ (1H-[1,2,4]oxadiazolo[4,3-a]quinoxalin-1-one).
Using Mendeleev's nomenclature for unnamed and undiscovered elements, nihonium would be known as eka-thallium. In 1979, IUPAC published recommendations according to which the element was to be called ununtrium (with the corresponding symbol of Uut), a systematic element name as a placeholder, until the discovery of the element is confirmed and a name is decided on. The recommendations were widely used in the chemical community on all levels, from chemistry classrooms to advanced textbooks, but were mostly ignored among scientists in the field, who called it "element 113", with the symbol of E113, (113), or even simply 113. Before the JWP recognition of their priority, the Japanese team had unofficially suggested various names: japonium, after their home country; nishinanium, after Japanese physicist Yoshio Nishina, the "founding father of modern physics research in Japan"; and rikenium, after the institute. After the recognition, the Riken team gathered in February 2016 to decide on a name. Morita expressed his desire for the name to honour the fact that element 113 had been discovered in Japan. Japonium was considered, making the connection to Japan easy to identify for non-Japanese, but it was rejected as Jap is considered an ethnic slur. The name nihonium was chosen after an hour of deliberation: it comes from Nihon (日本), one of the two Japanese pronunciations for the name of Japan.
Sources: en.wikipedia.org
Keep it in a sealed container in a cool, dry place away from direct heat and moisture. Dry powder is more stable than prepared solutions.
It can cyclize into creatinine, particularly in water or under heat. Creatinine does not support phosphocreatine energy buffering in the same way.
Laboratories commonly use chromatographic methods such as HPLC, along with spectroscopy and titration, to confirm identity and quantity. Moisture, elemental impurities, and microbial limits may also be tested.
In common usage, yes, but technically creatine monohydrate is one specific hydrated salt form. Other creatine forms exist and differ in composition and properties. The monohydrate is the most studied and most widely available grade.