A practical reference on creatine: what it is, how it behaves, what the literature reports, and where the honest uncertainties sit.
This page was last updated on 2025-08-01 and is reviewed periodically as new material appears.
Commercial creatine products appear in several forms, including monohydrate, hydrochloride, citrate, nitrate, and ethyl ester. Creatine monohydrate is the most studied form and serves as a reference material in comparative research. Different forms vary in solubility, pH, and water content, but they share creatine as the active moiety after dissolution. Claims that one form is uniformly superior remain debated, and study designs often differ in population, exercise protocol, and outcome measures. Purity and hydration state are central to interpreting product labels.
Creatine monohydrate is the hydrated form of creatine, a nitrogen-containing organic acid involved in cellular energy transfer. Its molecular formula is C4H11N3O3, and it consists of creatine plus one water molecule in the crystal lattice. The anhydrous base, creatine, has the formula C4H9N3O2. The compound appears as a white, odorless, crystalline powder and is classified as a guanidine derivative. It is distinct from creatinine, a breakdown product measured in clinical chemistry.
In animals, creatine is synthesized mainly in liver, kidney, and pancreas from arginine, glycine, and methionine. The first committed step transfers a guanidino group from arginine to glycine, forming guanidinoacetate. Subsequent methylation by S-adenosylmethionine yields creatine. Dietary sources include meat and fish; endogenous synthesis supplies part of the body pool. Most creatine is stored in skeletal muscle, where it is converted to phosphocreatine and participates in rapid regeneration of adenosine triphosphate during short, intense activity.
Quality assessment of creatine monohydrate typically uses high-performance liquid chromatography to separate creatine from creatinine and other impurities. Other methods include nuclear magnetic resonance spectroscopy, titration, and infrared spectroscopy for identity confirmation. Purity is often reported as a percentage of the labeled compound on a dry basis, while moisture content is measured separately. Because different analytical methods have different selectivity, comparing purity values across sources requires attention to the method and sample preparation.
In dry solid form, creatine monohydrate is relatively stable when protected from moisture and heat. The crystal lattice includes water, and exposure to high humidity can cause caking or gradual changes in powder flow. Elevated temperatures may accelerate decomposition, particularly if moisture is present. Studies generally report that sealed, dry material retains acceptable purity for extended periods, although exact shelf life depends on packaging and storage conditions. Light exposure is not usually considered a major factor for this compound.
In aqueous solution, creatine monohydrate undergoes a slow conversion to creatinine, a cyclized degradation product. This reaction is pH- and temperature-dependent, and it proceeds faster in warm or alkaline conditions. Because the conversion is gradual, analytical measurements of creatine in solution must account for time and storage history. The equilibrium favors creatinine more strongly at higher temperatures, which is relevant to sample handling in laboratories and to beverage formulations. Refrigeration slows but does not entirely stop this process.
| Property | Value | Notes |
|---|---|---|
| Chemical formula (monohydrate) | C4H11N3O3 | Includes one water molecule per creatine unit. |
| Molecular weight | 149.15 g/mol | Calculated for the monohydrate; anhydrous creatine is 131.13 g/mol. |
| Appearance | White crystalline powder | Odorless; particle size can vary by manufacturing. |
| CAS Registry Number | 6020-87-7 | Identifies creatine monohydrate; creatine base is 57-00-1. |
| Common synonyms | Creatine hydrate; methylguanidoacetic acid monohydrate | Naming varies by registry and supplier. |
In the human body, creatine is synthesized mainly in the liver and kidneys from the amino acids glycine, arginine, and methionine. Dietary sources include meat, fish, and other animal tissues, which supply preformed creatine. Because plant foods contain little or no creatine, dietary intake varies widely among populations. The compound is stored largely in skeletal muscle, where it is converted to phosphocreatine and used to regenerate adenosine triphosphate during short bursts of activity.
Creatine monohydrate is one of several solid forms of creatine described in the literature. Other forms include anhydrous creatine, creatine hydrochloride, and creatine ethyl ester, each with different solubility and stability characteristics. The monohydrate is distinct from creatinine, a spontaneous breakdown compound that forms when creatine loses water and cyclizes. Commercial descriptions sometimes use synonyms such as methylguanidoacetic acid or N-(aminoiminomethyl)-N-methylglycine, which refer to the same base molecule. These names appear in chemical databases and product labels.
Creatine monohydrate is a crystalline compound formed when one molecule of creatine binds with one molecule of water. Creatine itself is a nitrogen-containing organic acid involved in cellular energy transfer, particularly in muscle and nerve tissue. The monohydrate form is the most common solid form used in research and commercial products because it is relatively stable and easy to handle. Its molecular formula is C4H9N3O2·H2O, and its molar mass is about 149.15 grams per mole.
Creatine monohydrate is a crystalline compound formed from creatine and one water molecule in its solid lattice. Creatine itself is a nitrogen-containing organic acid involved in energy transfer in muscle and other tissues. The monohydrate form is the most common solid form used in research and commercial products because it is stable and easy to handle. The term "monohydrate" refers to the fixed one-to-one ratio of water to creatine in the crystal, not to moisture content. This distinction matters when comparing labels or calculating creatine content.
In chemical terms, creatine monohydrate is often described as N-(aminoiminomethyl)-N-methylglycine monohydrate, though nomenclature varies. Its solid state consists of zwitterionic creatine molecules linked with water through hydrogen bonding. The compound dissolves in water, but dissolution rate depends on particle size, temperature, and agitation. Once dissolved, the hydrate water becomes part of the solvent, leaving free creatine in solution. The monohydrate is not the same as creatine anhydrous, which lacks the water of crystallization and has a higher creatine fraction by mass.
Dry creatine monohydrate is generally stable when kept sealed and protected from heat and moisture. In solution, however, creatine undergoes a slow cyclization to creatinine, a related compound with no role in phosphocreatine storage. The rate of this conversion increases with temperature and is influenced by pH. Because creatinine is a common impurity in liquid or poorly stored products, analytical testing often measures both compounds. The crystalline monohydrate is less prone to degradation than aqueous preparations, though caking can occur if moisture enters the container.
Laboratory analysis of creatine monohydrate typically uses high-performance liquid chromatography to separate creatine from creatinine and other impurities. Detection may be ultraviolet, refractive index, or mass spectrometric, depending on the laboratory's equipment and the required sensitivity. Nuclear magnetic resonance spectroscopy can quantify the main component and identify related substances. Water content is measured by Karl Fischer titration, which is important because the monohydrate has a defined theoretical hydration level. Heavy metals, residual solvents, and microbial limits are also checked in quality control programs.
Commercial creatine monohydrate is produced mainly by chemical synthesis rather than extraction from animal tissue. Suppliers provide a certificate of analysis listing assay, water content, and impurity limits, and some products undergo third-party testing. Verification of identity can use infrared or Raman spectroscopy alongside chromatographic methods. Storage recommendations generally call for a cool, dry place and a tightly closed container to limit moisture uptake. Open questions include how packaging, flavoring agents, and long-term storage affect the stability of finished products.
Creatine monohydrate is a crystalline compound formed from creatine and one molecule of water. Creatine itself is a nitrogen-containing organic acid that occurs in vertebrate muscle and other tissues. The monohydrate designation refers to the water included in the crystal lattice, not to water added during manufacturing. Its chemical formula is commonly written as C4H9N3O2·H2O. The solid is typically a white, odorless powder with low solubility in water at room temperature. It is one of several creatine forms described in scientific and commercial literature.
The compound was identified in the nineteenth century after chemists isolated a nitrogenous substance from meat extracts. Later work established its role in muscle energy metabolism and its conversion to phosphocreatine. Chemical synthesis of creatine followed, and industrial production made the monohydrate widely available as a purified powder. Interest expanded in the late twentieth century when researchers began studying creatine supplementation and muscle physiology. Historical accounts sometimes differ on exact dates and attributions, but the broad sequence from tissue extracts to synthetic production is well documented.
3 cos Ω = 1 − 4 cos2 φ + ψ/2 The α-helix is tightly packed; there is almost no free space within the helix. The amino-acid side-chains are on the outside of the helix, and point roughly "downward" (i.e., toward the N-terminus), like the branches of an evergreen tree (Christmas tree effect). This directionality is sometimes used in preliminary, low-resolution electron-density maps to determine the direction of the protein backbone.
Corin converts the atrial natriuretic peptide (ANP) precursor, pro-ANP, to mature ANP, a cardiac hormone that regulates salt-water balance and blood pressure. In mice, corin deficiency prevents pro-ANP processing and causes salt-sensitive hypertension. Corin may also function as a pro-brain-type natriuretic peptide convertase. Corin-mediated ANP production in the pregnant uterus promotes spiral artery remodeling and trophoblast invasion. CORIN mutations have been reported in patients with preeclampsia. In mice, corin functions in the dermal papilla to regulate coat color in an Agouti-dependent pathway.
Some cecropins (e.g. cecropin A, and cecropin B) have anticancer properties and are called anticancer peptides (ACPs). Hybrid ACPs based on Cecropin A have been studied for anticancer properties. The fruit fly Defensin prevents tumour growth, suspected to bind to tumour cells owing to cell membrane modifications common to most cancer cells, such as phosphatidylserine exposure. Cecropin A can destroy planktonic and sessile biofilm-forming uropathogenic E. coli (UPEC) cells, either alone or when combined with the antibiotic nalidixic acid, synergistically clearing infection in vivo (in the insect host Galleria mellonella) without off-target cytotoxicity. The multi-target mechanism of action involves outer membrane permeabilization followed by biofilm disruption triggered by the inhibition of efflux pump activity and interactions with extracellular and intracellular nucleic acids. Recently there has been some research to identify potential antimicrobial peptides from prokaryotes, aquatic organisms such as fish, and shellfish, and monotremes such as echidnas.
Automated iterative homologation enables stepwise construction of carbon chains through repeated one-carbon extensions of boronic esters. Two reactions adapted to automation are the Matteson homologation, which inserts a methylene unit via chloromethyllithium, and chiral carbenoid homologation, which uses lithiated benzoate esters. Both methods have been implemented on robotic platforms under low-temperature, inert conditions. Using these techniques, up to six consecutive C(sp³)–C(sp³) bond-forming homologations have been performed without manual intervention, representing the highest number reported in an automated synthesis. The approach has also been applied to the synthesis of intermediates of the natural product (+)-kalkitoxin.
In 2007, Waters served as co-chair for the International Symposium on Dynamic Combinatorial Chemistry (November). The year after that, she was an advisory board member of International Symposia on Macrocyclic and Supramolecular Chemistry (ISMSC). In 2009, she was a guest editor for the December issue of Current Opinion in Chemical Biology. From 2009 to 2015, she was an advisory board member of International Symposia on Macrocyclic and Supramolecular Chemistry (ISMSC). In 2011, Waters was a co-organizer of the Mesilla Chemistry Workshop on "Aromatic Interactions in Chemistry and Biology"(with Ken Houk, UCLA Dept of Chemistry). In 2012, Waters was a section editor for "Supramolecular Chemistry: From Molecules to Nanomaterials" (John Wiley and Sons). In 2013, she was the co-chair, of American Peptide Society Meeting (with David Lawrence, UNC Dept of Chemistry) and a guest editor for Accounts of Chemical Research for the "Aromatic Interactions in Chemistry and Biology" article in the April issue. From 2014 to 2020, Waters was an editorial advisory board member of the Journal of the American Chemical Society.
Sources: en.wikipedia.org
One of the main roles of the INO80 subfamily is the incorporation and removal of alternate histones in the nucleosome. In the presence of the H2A.Z histone, the INO80 subfamily of remodelers catalyze the repositioning and eventual removal of this alternate histone. The H2A.Z histone is found on the first nucleosome at the beginning of genes. The INO80 subfamily of remodelers will also be recruited to the H2A.X histone in the homologous recombination repair pathway. In addition to this function, the INO80 subfamily plays a role in transcriptional regulation and genomic recombination. In the DNA damage pathways, the INO80 subfamily aids in repair, recombination, and cell cycle regulation. The INO80 subfamily can activate the recruitment of replication checkpoint factors and can aid in the recovery from replicative stress on the DNA strand. The subfamily's ability to incorporate alternate histones is important for genome stability, disease pathogenesis, and stem cell identity. INO80 complexes commonly bind to nucleosome free regions at transcription start sites and termination sites. INO80 is the only remodeler that is able to use the energy from ATP hydrolysis to create nucleosome free regions and cooperate with other remodelers to equally space nucleosomes.
The removal of dead cells by neighboring phagocytic cells has been termed efferocytosis. Dying cells that undergo the final stages of apoptosis display apoptotic-cell associated molecular patterns (ACAMPs), such as phosphatidylserine on the outer leaflet of the cell membrane. Phosphatidylserine is normally found on the inner leaflet surface of the plasma membrane, but is redistributed during apoptosis to the extracellular surface by a protein known as scramblase. These molecules mark the cell for phagocytosis by cells possessing the appropriate receptors, such as macrophages. The removal of dying cells by phagocytes occurs in an orderly manner without eliciting an inflammatory response. During apoptosis cellular RNA and DNA are separated from each other and sorted to different apoptotic bodies; separation of RNA is initiated as nucleolar segregation.
P-glycoprotein (3.A.1.201.1) is a well-studied protein associated with multi-drug resistance. It belongs to the human ABCB (MDR/TAP) family and is also known as ABCB1 or MDR1 Pgp. MDR1 consists of a functional monomer with two transmembrane domains (TMD) and two nucleotide-binding domains (NBD). This protein can transport mainly cationic or electrically neutral substrates as well as a broad spectrum of amphiphilic substrates. The structure of the full-size ABCB1 monomer was obtained in the presence and absence of nucleotide using electron cryo crystallography. Without the nucleotide, the TMDs are approximately parallel and form a barrel surrounding a central pore, with the opening facing towards the extracellular side of the membrane and closed at the intracellular face. In the presence of the nonhydrolyzable ATP analog, AMP-PNP, the TMDs have a substantial reorganization with three clearly segregated domains. A central pore, which is enclosed between the TMDs, is slightly open towards the intracellular face with a gap between two domains allowing access of substrate from the lipid phase. Substantial repacking and possible rotation of the TM helices upon nucleotide binding suggests a helix rotation model for the transport mechanism.
ProIAPP consists of 67 amino acids, which follow a 22 amino acid signal peptide which is rapidly cleaved after translation of the 89 amino acid coding sequence. The human sequence (from N-terminus to C-terminus) is: (MGILKLQVFLIVLSVALNHLKA) TPIESHQVEKR^ KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTYG^ KR^ NAVEVLKREPLNYLPL. The signal peptide is removed during translation of the protein and transport into the endoplasmic reticulum. Once inside the endoplasmic reticulum, a disulfide bond is formed between cysteine residues numbers 2 and 7. Later in the secretory pathway, the precursor undergoes additional proteolysis and posttranslational modification (indicated by ^). 11 amino acids are removed from the N-terminus by the enzyme proprotein convertase 2 (PC2) while 16 are removed from the C-terminus of the proIAPP molecule by proprotein convertase 1/3 (PC1/3). At the C-terminus Carboxypeptidase E then removes the terminal lysine and arginine residues. The terminal glycine amino acid that results from this cleavage allows the enzyme peptidylglycine alpha-amidating monooxygenase (PAM) to convert the terminal glycine to an amine group (releasing glycolate). After this step, the transformation from the precursor protein proIAPP to the biologically active IAPP (amylin) is complete (IAPP sequence: KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTY-NH2).
Sources: en.wikipedia.org
Femarelle is a dietary supplement range containing DT56a, a tofu-derived soy extract, together with additional ingredients including flaxseed powder, vitamins, and minerals. DT56a has been studied for its potential activity as a selective estrogen receptor modulator (SERM), meaning that it may interact selectively with estrogen receptors in different tissues. Femarelle has been evaluated in several clinical studies investigating its possible role in supporting women during menopause, including studies on menopausal symptoms, vaginal health, bone health, and safety profile. Some studies reported encouraging findings, including improvements in menopausal symptoms and a favorable safety profile compared with traditional hormone replacement therapy, although the published trials were generally limited by relatively small sample sizes and short study durations. In 2008, an application was submitted to the European Food Safety Authority (EFSA) regarding a health claim related to bone mineral density and osteoporosis risk. EFSA concluded that the available evidence at that time was insufficient to establish a cause-and-effect relationship between Femarelle consumption and improvements in bone mineral density or reduction of osteoporosis risk in postmenopausal women.
5-Oxo-eicosatetraenoic acid (i.e. 5-oxo-6E,8Z,11Z,14Z-eicosatetraenoic acid; also termed 5-oxo-ETE and 5-oxoETE) is a nonclassic eicosanoid metabolite of arachidonic acid and the most potent naturally occurring member of the 5-HETE family of cell signaling agents. Like other cell signaling agents, 5-oxo-ETE is made by a cell and then feeds back to stimulate its parent cell (see Autocrine signaling) and/or exits this cell to stimulate nearby cells (see Paracrine signaling). 5-Oxo-ETE can stimulate various cell types particularly human leukocytes but possesses its highest potency and power in stimulating the human eosinophil type of leukocyte. It is therefore suggested to be formed during and to be an important contributor to the formation and progression of eosinophil-based allergic reactions; it is also suggested that 5-oxo-ETE contributes to the development of inflammation, cancer cell growth, and other pathological and physiological events.
Hydrogen halides and their solutions: hydrofluoric acid (HF), hydrochloric acid (HCl), hydrobromic acid (HBr), hydroiodic acid (HI) Halogen oxoacids: hypochlorous acid (HClO), chlorous acid (HClO2), chloric acid (HClO3), perchloric acid (HClO4), and corresponding analogs for bromine and iodine Hypofluorous acid (HFO), the only known oxoacid for fluorine. Sulfuric acid (H2SO4) Fluorosulfuric acid (HSO3F) Nitric acid (HNO3) Phosphoric acid (H3PO4) Fluoroantimonic acid (HSbF6) Fluoroboric acid (HBF4) Hexafluorophosphoric acid (HPF6) Chromic acid (H2CrO4) Boric acid (H3BO3) A sulfonic acid has the general formula RS(=O)2–OH, where R is an organic radical. Methanesulfonic acid (or mesylic acid, CH3SO3H) Ethanesulfonic acid (or esylic acid, CH3CH2SO3H) Benzenesulfonic acid (or besylic acid, C6H5SO3H) p-Toluenesulfonic acid (or tosylic acid, CH3C6H4SO3H) Trifluoromethanesulfonic acid (or triflic acid, CF3SO3H) Polystyrene sulfonic acid (sulfonated polystyrene, [CH2CH(C6H4)SO3H]n)
Sources: en.wikipedia.org
Creatine is the base compound, while creatine monohydrate includes one water molecule per creatine molecule in its crystal structure. The monohydrate form is common in supplements and analytical standards. The body uses creatine itself after the water is removed or dissociated.
Yes. Meat, fish, and other animal tissues contain creatine. Cooking can convert some creatine to creatinine, which has no role in phosphocreatine energy buffering. Plant foods contain little or no creatine.
Creatinine is a cyclic breakdown product formed from creatine and phosphocreatine. It is filtered by the kidneys and commonly measured in blood and urine as a marker of renal function. Creatine monohydrate is a supplement ingredient and research chemical, not the same molecule.
Dry, sealed creatine monohydrate can remain stable for years, but storage conditions affect its shelf life. Moisture, heat, and repeated opening of containers can reduce quality over time.