A practical reference on Creatinine: what it is, how it behaves, what the literature reports, and where the honest uncertainties sit.
This page was last updated on 2025-09-05 and is reviewed periodically as new material appears.
In the body, creatine is synthesized from the amino acids arginine, glycine, and methionine, primarily in the liver and kidneys. It is transported to muscle and other tissues, where it is phosphorylated to phosphocreatine by creatine kinase. This phosphagen system provides a rapid source of adenosine triphosphate during short, intense contractions. Dietary creatine comes mainly from meat and fish, and the body's total pool is influenced by both synthesis and intake.
As a supplement, creatine monohydrate is studied for its effects on muscle performance and recovery. The compound is often described as an ergogenic aid, meaning it may support physical work capacity. Research typically compares it with placebo or other forms, such as citrate or nitrate, under controlled conditions. Questions remain about the optimal dose and long-term effects in different populations, and findings are not uniform across all studies. The monohydrate form remains the most extensively tested.
Creatine monohydrate is a crystalline compound formed from creatine and one molecule of water. Its systematic name is N-(aminoiminomethyl)-N-methylglycine monohydrate, and it appears as a white, odorless powder with limited solubility in water. The monohydrate is the most common solid form used in research and commercial products because it is stable under dry conditions. The anhydrous form lacks the water of crystallization and differs slightly in molar mass. Both forms participate in the same biochemical reactions once dissolved.
Solid creatine monohydrate is generally stable when kept cool and dry, but it can hydrolyze to creatinine over time. Moisture, heat, and acidic conditions accelerate this conversion, which reduces assay values and changes the material's properties. Creatinine is a cyclic dehydration product that is also a normal human metabolite, so its presence in a sample is not necessarily a health concern by itself. In quality testing, creatinine is monitored as a marker of degradation and purity.
Identity and purity are assessed with several complementary methods. High-performance liquid chromatography can separate creatine from creatinine and related impurities, often with ultraviolet detection. Nuclear magnetic resonance and infrared spectroscopy provide structural confirmation, while Karl Fischer titration measures water content. Elemental analysis and mass spectrometry may be used for additional confirmation, especially in research or forensic settings. No single method captures every quality attribute, so laboratories typically combine results and compare them against a specification.
| Property | Value | Notes |
|---|---|---|
| Chemical formula | C4H9N3O2·H2O | Monohydrate form; anhydrous is C4H9N3O2 |
| Molar mass | 149.15 g/mol | For the monohydrate |
| Appearance | White crystalline powder | Odorless, slightly bitter taste |
| Solubility in water | ~13 g/L at 25 °C | Poorly soluble; increases with temperature |
| CAS Registry Number | 6020-87-7 | For creatine monohydrate |
Quality control for creatine monohydrate begins with identity confirmation and assay determination. Laboratories commonly use high-performance liquid chromatography with ultraviolet detection, often after derivatization or using a suitable column, to quantify creatine. Karl Fischer titration measures water content, which helps verify the monohydrate stoichiometry. Additional tests screen for heavy metals, residual solvents, and microbial contamination depending on the intended use. These tests establish composition and purity rather than biological effect.
Stability studies examine how creatine monohydrate changes under controlled temperature and humidity. The solid is generally stable when kept dry, but moisture can promote hydrolysis to creatinine, especially in solution or at elevated temperatures. Color, odor, and assay values are monitored over time to detect degradation. Because degradation pathways depend on storage conditions, shelf-life claims should specify the tested packaging, temperature, and humidity. Open questions remain about the long-term behavior of different crystal habits and particle sizes.
Regulatory treatment of creatine monohydrate varies by country and intended use. In some jurisdictions it is sold as a dietary supplement, while in others it may be treated as a food ingredient or a pharmaceutical raw material. Pharmacopeial monographs, where available, define identification, assay limits, and impurity thresholds. Manufacturers often follow these monographs or internal specifications to ensure batch-to-batch consistency. Analytical method validation is important because different methods can yield different apparent purity values if sample preparation or detection conditions are not controlled.
Manufacturing processes can leave trace amounts of dicyandiamide, creatinine, or residual solvents, depending on the synthetic route and purification steps. Heavy metals, arsenic, and microbial contamination are also monitored for food or pharmaceutical grades. Particle size distribution can affect dissolution behavior and blending uniformity, so it may be specified for certain applications. Analytical results are reported on a dry basis or as-is basis, and the difference matters when comparing certificates of analysis. Open questions remain about how minor impurities influence long-term stability under varied storage conditions.
Stability studies typically examine the effects of temperature, humidity, and light on creatine monohydrate. Sealed containers stored in cool, dry conditions help limit moisture uptake and hydrolysis. Elevated temperature and high relative humidity can accelerate conversion to creatinine, especially in aqueous solutions. In solid dosage forms, excipients and processing steps may also affect stability. Published stability data are not fully consistent across studies because test conditions and analytical methods vary.
Commercial creatine products appear in several forms, including monohydrate, hydrochloride, citrate, nitrate, and ethyl ester. Creatine monohydrate is the most studied form and serves as a reference material in comparative research. Different forms vary in solubility, pH, and water content, but they share creatine as the active moiety after dissolution. Claims that one form is uniformly superior remain debated, and study designs often differ in population, exercise protocol, and outcome measures. Purity and hydration state are central to interpreting product labels.
Creatine monohydrate is the hydrated form of creatine, a nitrogen-containing organic acid involved in cellular energy transfer. Its molecular formula is C4H11N3O3, and it consists of creatine plus one water molecule in the crystal lattice. The anhydrous base, creatine, has the formula C4H9N3O2. The compound appears as a white, odorless, crystalline powder and is classified as a guanidine derivative. It is distinct from creatinine, a breakdown product measured in clinical chemistry.
In animals, creatine is synthesized mainly in liver, kidney, and pancreas from arginine, glycine, and methionine. The first committed step transfers a guanidino group from arginine to glycine, forming guanidinoacetate. Subsequent methylation by S-adenosylmethionine yields creatine. Dietary sources include meat and fish; endogenous synthesis supplies part of the body pool. Most creatine is stored in skeletal muscle, where it is converted to phosphocreatine and participates in rapid regeneration of adenosine triphosphate during short, intense activity.
Quality assessment of creatine monohydrate typically uses high-performance liquid chromatography to separate creatine from creatinine and other impurities. Other methods include nuclear magnetic resonance spectroscopy, titration, and infrared spectroscopy for identity confirmation. Purity is often reported as a percentage of the labeled compound on a dry basis, while moisture content is measured separately. Because different analytical methods have different selectivity, comparing purity values across sources requires attention to the method and sample preparation.
In dry solid form, creatine monohydrate is relatively stable when protected from moisture and heat. The crystal lattice includes water, and exposure to high humidity can cause caking or gradual changes in powder flow. Elevated temperatures may accelerate decomposition, particularly if moisture is present. Studies generally report that sealed, dry material retains acceptable purity for extended periods, although exact shelf life depends on packaging and storage conditions. Light exposure is not usually considered a major factor for this compound.
Slavery is the ownership of a person as property, especially in regard to their labour. It is an economic phenomenon and its history resides in economic history. Slavery typically involves compulsory work, with the slave's location of work and residence dictated by the party that holds them in bondage. Enslavement is the placement of a person into slavery, and the person is called a slave or an enslaved person. Many historical cases of enslavement occurred as a result of breaking the law, becoming indebted, suffering a military defeat, or exploitation for cheaper labor; other forms of slavery were instituted along demographic lines such as race or sex. Slaves would be kept in bondage for life, or for a fixed period of time after which they would be granted freedom. Although slavery is usually involuntary and involves coercion, there are also cases where people voluntarily enter into slavery to pay a debt or earn money due to poverty. In the course of human history, slavery was a common feature of civilization, and existed in most societies throughout history, but it is now outlawed in every country in the world except as a punishment for a crime. In general there were two types of slavery throughout human history: domestic and productive. In chattel slavery, the slave is legally rendered the personal property (chattel) of the slave owner. In economics, the term de facto slavery describes the conditions of unfree labour and forced labour that most slaves endure.
A photograph of the deceased in good health is often sought to guide the embalmer's hand in restoring the body to a more lifelike appearance. Blemishes and discolorations (such as bruises, in which the discoloration is not in the circulatory system, and cannot be removed by arterial injection) occasioned by the last illness, the settling of blood, or the embalming process itself are also dealt with at this time (although some embalmers utilize hypodermic bleaching agents, such as phenol-based cauterants, during injection to lighten discoloration and allow easier cosmeticizing). It is also common for the embalmer to perform minor restoration of the deceased's appearance with tissue building chemicals and a hypodermic syringe. Tissue building chemicals (Tissue Builders) become solid with the introduction of liquids such as water or interstitial fluids. Commonly the area where the sphenoid and temporal bones meet; this can also be referred to the temples. In the event of trauma or natural depressions on the face or hands, tissue builder can also be utilised to return those regions of the face to the expectations of the family.
Glucagon-like peptide-2 (GLP-2) is a 33 amino acid peptide with the sequence HADGSFSDEMNTILDNLAARDFINWLIQTKITD (see Proteinogenic amino acid) in humans. GLP-2 is created by specific post-translational proteolytic cleavage of proglucagon in a process that also liberates the related glucagon-like peptide-1 (GLP-1). GLP-2 is produced by the intestinal endocrine L cell and by various neurons in the central nervous system. Intestinal GLP-2 is co-secreted along with GLP-1 upon nutrient ingestion. When externally administered, GLP-2 produces a number of effects in humans and rodents, including intestinal growth, enhancement of intestinal function, reduction in bone breakdown and neuroprotection. GLP-2 may act in an endocrine fashion to link intestinal growth and metabolism with nutrient intake. GLP-2 and related analogs (such as Teduglutide) may be treatments for short bowel syndrome, Crohn's disease, osteoporosis and as adjuvant therapy during cancer chemotherapy. GLP-2 has an antidepressant effect in a mouse model of depression when delivered via intracerebroventricular injection. However, a GLP-2 derivative (PAS-CPP-GLP-2) was shown to be efficiently delivered to the brain intranasally, with similar efficacy.
Sources: en.wikipedia.org
Hyperthyroidism is a endocrine disease in which the thyroid gland produces excessive amounts of thyroid hormones. Thyrotoxicosis is a condition that occurs due to elevated levels of thyroid hormones of any cause and therefore includes hyperthyroidism. Some, however, use the terms interchangeably. Signs and symptoms vary between people and may include irritability, muscle weakness, sleeping problems, a fast heartbeat, heat intolerance, diarrhea, enlargement of the thyroid, hand tremor, and weight loss. Symptoms are typically less severe in the elderly and during pregnancy. An uncommon but life-threatening complication is thyroid storm in which an event such as an infection results in worsening symptoms such as confusion and a high temperature; this often results in death. The opposite is hypothyroidism, when the thyroid gland does not make enough thyroid hormone. Graves' disease is the cause of about 50% to 80% of the cases of hyperthyroidism in the United States. Other causes include multinodular goiter, toxic adenoma, inflammation of the thyroid, eating too much iodine, and too much synthetic thyroid hormone. A less common cause is a pituitary adenoma. The diagnosis may be suspected based on signs and symptoms and then confirmed with blood tests. Typically blood tests show a low thyroid stimulating hormone (TSH) and raised T3 or T4. Radioiodine uptake by the thyroid, thyroid scan, and measurement of antithyroid autoantibodies (thyroidal thyrotropin receptor antibodies are positive in Graves' disease) may help determine the cause.
=== Osmium tetroxide (formal name: osmium tetraoxide) === Osmium tetraoxide is used in optical microscopy to stain lipids. It dissolves in fats, and is reduced by organic materials to elemental osmium, an easily visible black substance.
Grammotoxin is a toxin in the venom of the tarantula Grammostola spatulata. It is a protein toxin that inhibits P-, Q- and N-type voltage-gated calcium channels (Ca 2+ channels) in neurons. Grammotoxin is also known as omega-grammotoxin SIA.
Sources: en.wikipedia.org
It is a compound made of creatine bound to one water molecule. It appears as a white crystalline powder and is the most common solid form of creatine used in research and supplements.
Creatine is converted to phosphocreatine in muscle, which helps regenerate adenosine triphosphate during brief, high-intensity activity. The body also obtains creatine from foods such as meat and fish.
The creatine molecule is the same whether from food or supplements, but the monohydrate form includes a water molecule in its crystal structure. Once dissolved, the monohydrate and food-derived creatine are chemically identical in the body.
A sealed container kept at room temperature and away from moisture is typical. Heat and humidity promote conversion to creatinine and can reduce assay values. Long-term storage under dry conditions helps maintain the original crystalline form.